PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bv9_221980_hehi.t1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Chenopodiaceae; Betoideae; Beta
Family MIKC_MADS
Protein Properties Length: 217aa    MW: 24771.2 Da    PI: 7.5705
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bv9_221980_hehi.t1genomeTBVRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF87.85.9e-28959151
                        S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
              SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                        +ri+n + rqvtf+kRr+g++KKA+ELS+LCdaev +iifss+gk+ye++s
  Bv9_221980_hehi.t1  9 ERIDNVTSRQVTFTKRRKGLFKKAKELSILCDAEVGIIIFSSSGKVYEFAS 59
                        69***********************************************86 PP

2K-box74.43.2e-2575169698
               K-box   6 gks..leeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaL 94 
                          ++  + +++a+ ++ e++ L++++e L+ + R+llGedL++L++++L+ Le+qLe + k iR++K+e+++++i++l k e  +++en++L
  Bv9_221980_hehi.t1  75 ENQvlNPTSEAQLWKVEAESLRQQLEDLRMNSRQLLGEDLSELTIEHLETLENQLEMGTKAIRTRKKEIFKAKIQDLNKTEILVHQENMEL 165
                         44445778999******************************************************************************** PP

               K-box  95 rkkl 98 
                         +kk+
  Bv9_221980_hehi.t1 166 HKKI 169
                         **98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004322.3E-38160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006630.81161IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.7E-31287IPR002100Transcription factor, MADS-box
CDDcd002654.12E-38274No hitNo description
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004041.2E-27323IPR002100Transcription factor, MADS-box
PfamPF003193.2E-251057IPR002100Transcription factor, MADS-box
PRINTSPR004041.2E-272338IPR002100Transcription factor, MADS-box
PRINTSPR004041.2E-273859IPR002100Transcription factor, MADS-box
PfamPF014866.3E-2382169IPR002487Transcription factor, K-box
PROSITE profilePS5129713.54885175IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 217 aa     Download sequence    Send to blast
MGRGKISIER IDNVTSRQVT FTKRRKGLFK KAKELSILCD AEVGIIIFSS SGKVYEFASH  60
CMQSLLQRYY KANEENQVLN PTSEAQLWKV EAESLRQQLE DLRMNSRQLL GEDLSELTIE  120
HLETLENQLE MGTKAIRTRK KEIFKAKIQD LNKTEILVHQ ENMELHKKIN LMRQEMSELQ  180
KKVSAGSGKD DQEGAEGGAS SSKSAYDSYD PIELKLS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3kov_A5e-20277176Myocyte-specific enhancer factor 2A
3kov_B5e-20277176Myocyte-specific enhancer factor 2A
3kov_I5e-20277176Myocyte-specific enhancer factor 2A
3kov_J5e-20277176Myocyte-specific enhancer factor 2A
3p57_A5e-20277176Myocyte-specific enhancer factor 2A
3p57_B5e-20277176Myocyte-specific enhancer factor 2A
3p57_C5e-20277176Myocyte-specific enhancer factor 2A
3p57_D5e-20277176Myocyte-specific enhancer factor 2A
3p57_I5e-20277176Myocyte-specific enhancer factor 2A
3p57_J5e-20277176Myocyte-specific enhancer factor 2A
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010691448.11e-159PREDICTED: MADS-box transcription factor 23-like
SwissprotQ6EP491e-75MAD27_ORYSJ; MADS-box transcription factor 27
TrEMBLA0A0J8BLM71e-158A0A0J8BLM7_BETVU; Uncharacterized protein
STRINGOB04G22330.12e-74(Oryza brachyantha)
STRINGGSMUA_Achr3P07310_0012e-74(Musa acuminata)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G57230.11e-70AGAMOUS-like 16